PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009764264.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 293aa    MW: 33000.2 Da    PI: 6.5177
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009764264.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-18128182256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq  +Lee F+++++++ +++  L+k+l+L  rqV vWFqNrRa+ k
  XP_009764264.1 128 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALSKQLNLRPRQVEVWFQNRRARTK 182
                     788899***********************************************98 PP

2HD-ZIP_I/II125.72.1e-40128217191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq+++LEe+F+e+++L+p++K +l+++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+kev+eLr +l
  XP_009764264.1 128 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALSKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCENLTEENRRLQKEVTELR-AL 217
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575119No hitNo description
PfamPF046181.6E-174104IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466895.13E-18121185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-17124187IPR009057Homeodomain-like
PROSITE profilePS5007116.925124184IPR001356Homeobox domain
SMARTSM003896.6E-15126188IPR001356Homeobox domain
PfamPF000469.7E-16128182IPR001356Homeobox domain
CDDcd000868.21E-15128185No hitNo description
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
PfamPF021838.5E-11184218IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.1E-25184227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGGEKEDGLG LSLSLGMSCP QNNLKNNDFI SPSTPPFLLP FMHNHQISAE RNEEAREFIR  60
GEIDMNRPVR MIEACDEELE DEAVIMVSSP NNSTVSSVSG KRSHDREDNE GERPTSSLED  120
DGGDAAARKK LRLSKEQAAV LEETFKEHNT LNPKQKLALS KQLNLRPRQV EVWFQNRRAR  180
TKLKQTEVDC EYLRRCCENL TEENRRLQKE VTELRALKLS PQMYMNMTPP TTLTMCPQCE  240
RVAVSSSSSS VTSAGVSRSN HPVGALHQPP VPLNKPWAAI FSPKTLDDQR TQL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176184RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764264.10.0PREDICTED: homeobox-leucine zipper protein HAT3
SwissprotP929531e-84ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLQ424371e-150Q42437_SOLLC; HD-ZIP protein
STRINGSolyc01g090460.2.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.14e-77homeobox-leucine zipper protein 3